Structure of PDB 3dt9 Chain A

Receptor sequence

>3dt9A (length=212) Species: 9913 (Bos taurus)

ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQ
SEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTN
NHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRR
VNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPV
CRALHSLLLRLL

3D structure

• PDB: 3dt9 Crystal structures of brain group-VIII phospholipase A2 in nonaged complexes with the organophosphorus nerve agents soman and sarin.
• Chain: A
• Resolution: 1.85 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S47 G74 N104 D192 H195
• Catalytic site (residue number reindexed from 1): S43 G70 N100 D188 H191
• Enzyme Commision number: 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GD7	A	S47 G73 G74 N104 L194 H195	S43 G69 G70 N100 L190 H191

Gene Ontology

Molecular Function

• GO:0003847 1-alkyl-2-acetylglycerophosphocholine esterase activity
• GO:0016787 hydrolase activity
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046982 protein heterodimerization activity
• GO:0047179 platelet-activating factor acetyltransferase activity

Biological Process

• GO:0007283 spermatogenesis
• GO:0016042 lipid catabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0008247 1-alkyl-2-acetylglycerophosphocholine esterase complex

External links

• PDB: RCSB:3dt9, PDBe:3dt9, PDBj:3dt9
• PDBsum: 3dt9
• PubMed: 19271773
• UniProt: Q29460|PA1B3_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha1 (Gene Name=PAFAH1B3)