Structure of PDB 3dso Chain A |
>3dsoA (length=66) Species: 266264 (Cupriavidus metallidurans CH34) [Search protein sequence] |
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGT KIIMKGNEIFRLDEAL |
|
PDB | 3dso Unprecedented binding cooperativity between Cu(I) and Cu(II) in the copper resistance protein CopK from Cupriavidus metallidurans CH34: implications from structural studies by NMR spectroscopy and X-ray crystallography |
Chain | A |
Resolution | 1.55 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
M26 M38 M54 |
M26 M38 M54 |
|
|
|
|