Structure of PDB 3dof Chain A

Receptor sequence
>3dofA (length=189) Species: 9606 (Homo sapiens) [Search protein sequence]
GLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFN
IKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQD
CQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHH
WCIQGCSAVTGENLLPGIDWLLDDISSRIFTADLEHHHH
3D structure
PDB3dof Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
ChainA
Resolution3.3 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Q70
Catalytic site (residue number reindexed from 1) Q69
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GTP A D25 N26 A27 G28 K29 T30 T31 T47 G69 N125 K126 D128 S158 A159 V160 D24 N25 A26 G27 K28 T29 T30 T46 G68 N124 K125 D127 S157 A158 V159
BS02 MG A T30 T47 T29 T46
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019003 GDP binding
Biological Process
GO:0006110 regulation of glycolytic process
GO:0006457 protein folding
GO:0007098 centrosome cycle
GO:0010811 positive regulation of cell-substrate adhesion
GO:0031113 regulation of microtubule polymerization
GO:0031116 positive regulation of microtubule polymerization
GO:0034260 negative regulation of GTPase activity
GO:0051457 maintenance of protein location in nucleus
GO:0070830 bicellular tight junction assembly
GO:1903715 regulation of aerobic respiration
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005759 mitochondrial matrix
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005925 focal adhesion
GO:0005929 cilium
GO:0015630 microtubule cytoskeleton
GO:0016328 lateral plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3dof, PDBe:3dof, PDBj:3dof
PDBsum3dof
PubMed19368893
UniProtP36404|ARL2_HUMAN ADP-ribosylation factor-like protein 2 (Gene Name=ARL2)

[Back to BioLiP]