Structure of PDB 3dng Chain A

Receptor sequence
>3dngA (length=163) Species: 9606 (Homo sapiens) [Search protein sequence]
MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFT
RISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAE
ETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSL
PQDDIDGIQAIYG
3D structure
PDB3dng Extra Binding Region Induced by Non-Zinc Chelating Inhibitors into the S(1)' Subsite of Matrix Metalloproteinase 8 (MMP-8)
ChainA
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H197 E198 H201 H207
Catalytic site (residue number reindexed from 1) H118 E119 H122 H128
Enzyme Commision number 3.4.24.34: neutrophil collagenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D137 G169 G171 D173 D58 G90 G92 D94
BS02 CA A D154 G155 N157 I159 D177 E180 D75 G76 N78 I80 D98 E101
BS03 ZN A H147 D149 H162 H175 H68 D70 H83 H96
BS04 ZN A H197 H201 H207 H118 H122 H128
BS05 AXA A L193 H197 L214 Y216 P217 N218 Y219 A220 F221 R222 Y227 P230 L114 H118 L135 Y137 P138 N139 Y140 A141 F142 R143 Y148 P151 MOAD: ic50=7.4nM
PDBbind-CN: -logKd/Ki=8.13,IC50=7.4nM
BindingDB: IC50=7.4nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3dng, PDBe:3dng, PDBj:3dng
PDBsum3dng
PubMed19173605
UniProtP22894|MMP8_HUMAN Neutrophil collagenase (Gene Name=MMP8)

[Back to BioLiP]