Structure of PDB 3diw Chain A

Receptor sequence
>3diwA (length=108) Species: 10090 (Mus musculus) [Search protein sequence]
PVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYV
TRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRL
LVTRQSLQ
3D structure
PDB3diw Structural Basis of beta-Catenin Recognition by Tax-interacting Protein-1
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A I28 L29 G30 F31 S32 I33 G34 G35 D38 Q39 D40 Q43 N44 P45 T58 R59 H90 L97 I21 L22 G23 F24 S25 I26 G27 G28 D31 Q32 D33 Q36 N37 P38 T51 R52 H83 L90
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008013 beta-catenin binding
Biological Process
GO:0007266 Rho protein signal transduction
GO:0008285 negative regulation of cell population proliferation
GO:0016055 Wnt signaling pathway
GO:0030178 negative regulation of Wnt signaling pathway
GO:0090630 activation of GTPase activity
GO:2000009 negative regulation of protein localization to cell surface
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0015629 actin cytoskeleton
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3diw, PDBe:3diw, PDBj:3diw
PDBsum3diw
PubMed18835279
UniProtQ9DBG9|TX1B3_MOUSE Tax1-binding protein 3 (Gene Name=Tax1bp3)

[Back to BioLiP]