Structure of PDB 3dht Chain A

Receptor sequence

>3dhtA (length=139) Species: 10116 (Rattus norvegicus)

VLSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVSP
GSAQVKAHGKKVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFKF
LSHCLLVTLACHHPGDFTPAMHASLDKFLASVSTVLTSK

3D structure

• PDB: 3dht Crystal structure of hemoglobin from the maned wolf (Chrysocyon brachyurus) using synchrotron radiation
• Chain: A
• Resolution: 2.98 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	H45 H58 K61 L83 L86 H87 L91 F98 L101	H45 H58 K61 L83 L86 H87 L91 F98 L101

Gene Ontology

Molecular Function

• GO:0001540 amyloid-beta binding
• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001701 in utero embryonic development
• GO:0009617 response to bacterium
• GO:0015670 carbon dioxide transport
• GO:0015671 oxygen transport
• GO:0030185 nitric oxide transport
• GO:0035634 response to stilbenoid
• GO:0042744 hydrogen peroxide catabolic process
• GO:0045776 negative regulation of blood pressure
• GO:0048821 erythrocyte development
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:3dht, PDBe:3dht, PDBj:3dht
• PDBsum: 3dht
• UniProt: P01946|HBA_RAT Hemoglobin subunit alpha-1/2 (Gene Name=Hba1)