Structure of PDB 3dd7 Chain A

Receptor sequence
>3dd7A (length=123) Species: 10678 (Punavirus P1) [Search protein sequence]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITD
LFEVSATYLVATARGYIFNDANKRTALNSALLFLRRNGVQVFDSPELADL
TVGAATGEISVSSVADTLRRLYG
3D structure
PDB3dd7 Doc of Prophage P1 Is Inhibited by Its Antitoxin Partner Phd through Fold Complementation
ChainA
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A A11 L12 A15 N16 R19 Y20 K73 R74 N78 L81 L82 R85 D93 A98 A11 L12 A15 N16 R19 Y20 K73 R74 N78 L81 L82 R85 D93 A98
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0044024 histone H2AS1 kinase activity
GO:0106310 protein serine kinase activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006417 regulation of translation
GO:0016310 phosphorylation
GO:0039604 symbiont-mediated suppression of host translation
GO:0044696 killing by virus of host cell by post-segregational killing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3dd7, PDBe:3dd7, PDBj:3dd7
PDBsum3dd7
PubMed18757857
UniProtQ06259|DOC_BPP1 Protein kinase doc (Gene Name=doc)

[Back to BioLiP]