Structure of PDB 3dcj Chain A

Receptor sequence

>3dcjA (length=206) Species: 1773 (Mycobacterium tuberculosis)

EPLRVPPSAPARLVVLASGTGSLLRSLLDAAVGDYPARVVAVGVDRECRA
AEIAAEASVPVFTVRLADHPSRDAWDVAITAATAAHEPDLVVSAGFMRIL
GPQFLSRFYGRTLNTHPALLPAFPGTHGVADALAYGVKVTGATVHLVDAG
TDTGPILAQQPVPVLDGDDEETLHERIKVTERRLLVAAVAALATHGVTVV
GRTATM

3D structure

• PDB: 3dcj Structures of glycinamide ribonucleotide transformylase (PurN) from Mycobacterium tuberculosis reveal a novel dimer with relevance to drug discovery.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N116 H118 T145 D154
• Catalytic site (residue number reindexed from 1): N114 H116 T143 D152
• Enzyme Commision number: 2.1.2.2: phosphoribosylglycinamide formyltransferase 1.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	THH	A	F98 M99 R100 I101 L102 N116 T128 V149 D150 G152 T153	F96 M97 R98 I99 L100 N114 T126 V147 D148 G150 T151

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004644 phosphoribosylglycinamide formyltransferase activity
• GO:0005515 protein binding
• GO:0016740 transferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0006189 'de novo' IMP biosynthetic process
• GO:0009058 biosynthetic process
• GO:0046653 tetrahydrofolate metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3dcj, PDBe:3dcj, PDBj:3dcj
• PDBsum: 3dcj
• PubMed: 19394344
• UniProt: P9WHM5|PUR3_MYCTU Phosphoribosylglycinamide formyltransferase (Gene Name=purN)