Structure of PDB 3d7m Chain A

Receptor sequence
>3d7mA (length=305) Species: 10116 (Rattus norvegicus) [Search protein sequence]
VKLLLLGAGESGKSTIVKQMKICHEAGYSEEECKQYKAVVYSNTIQSIIA
IIRAMGRLKIDFGDAARADDARQLFVLAAELAGVIKRLWKDSGVQACFNR
SREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFK
DLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNR
MHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAG
SNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVCFVFDAVTDV
IIKNN
3D structure
PDB3d7m Helix dipole movement and conformational variability contribute to allosteric GDP release in Galphai subunits.
ChainA
Resolution2.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E43 T48 R178 D200 Q204
Catalytic site (residue number reindexed from 1) E10 T15 R136 D158 Q162
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A S47 T181 S14 T139
BS02 ALF A E43 K46 R178 K180 T181 G203 Q204 E10 K13 R136 K138 T139 G161 Q162
BS03 GDP A E43 S44 G45 K46 S47 T48 S151 R176 T177 R178 N269 K270 D272 L273 C325 A326 E10 S11 G12 K13 S14 T15 S109 R134 T135 R136 N227 K228 D230 L231 C283 A284 PDBbind-CN: -logKd/Ki=6.44,Kd=0.36uM
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0001664 G protein-coupled receptor binding
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019001 guanyl nucleotide binding
GO:0019003 GDP binding
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0031749 D2 dopamine receptor binding
GO:0031821 G protein-coupled serotonin receptor binding
GO:0032794 GTPase activating protein binding
GO:0046872 metal ion binding
Biological Process
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0043949 regulation of cAMP-mediated signaling
GO:0050805 negative regulation of synaptic transmission
GO:0051301 cell division
GO:0060236 regulation of mitotic spindle organization
GO:0099645 neurotransmitter receptor localization to postsynaptic specialization membrane
GO:1904322 cellular response to forskolin
GO:1904778 positive regulation of protein localization to cell cortex
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005834 heterotrimeric G-protein complex
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0005938 cell cortex
GO:0030496 midbody
GO:0032991 protein-containing complex
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3d7m, PDBe:3d7m, PDBj:3d7m
PDBsum3d7m
PubMed19222191
UniProtP10824|GNAI1_RAT Guanine nucleotide-binding protein G(i) subunit alpha-1 (Gene Name=Gnai1)

[Back to BioLiP]