Structure of PDB 3d2t Chain A

Receptor sequence

>3d2tA (length=115) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTN

3D structure

• PDB: 3d2t Diflunisal analogues stabilize the native state of transthyretin. Potent inhibition of amyloidogenesis.
• Chain: A
• Resolution: 1.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1FL	A	K15 A108 L110 T119	K6 A99 L101 T110	MOAD: Kd=75nM PDBbind-CN: -logKd/Ki=7.12,Kd=75nM BindingDB: IC50=12000nM,Kd=407nM,EC50=5600nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3d2t, PDBe:3d2t, PDBj:3d2t
• PDBsum: 3d2t
• PubMed: 14711308
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)