Structure of PDB 3d1k Chain A

Receptor sequence
>3d1kA (length=142) Species: 35730 (Trematomus newnesi) [Search protein sequence]
SLSDKDKAAVRALWSKIGKSSDAIGNDALSRMIVVYPQTKIYFSHWPDVT
PGSPNIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYKLRVDPSNFK
ILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR
3D structure
PDB3d1k Spectroscopic and crystallographic characterization of a tetrameric hemoglobin oxidation reveals structural features of the functional intermediate relaxed/tense state.
ChainA
Resolution1.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEM A Y42 F43 H45 H59 L84 Q87 H88 L92 V94 N98 L102 L137 Y42 F43 H45 H59 L84 Q87 H88 L92 V94 N98 L102 L137
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3d1k, PDBe:3d1k, PDBj:3d1k
PDBsum3d1k
PubMed18642904
UniProtP45718|HBA1_TRENE Hemoglobin subunit alpha-1 (Gene Name=hba1)

[Back to BioLiP]