Structure of PDB 3czx Chain A

Receptor sequence

>3czxA (length=182) Species: 122586 (Neisseria meningitidis MC58)

AMSKIICLTAGHSNTDPGAVNGSDREADLAQDMRNIVASILRNDYGLTVK
TDGTGKGNMPLRDAVKLIRGSDVAIEFHTNAAANKTATGIEALSTPKNKR
WCQVLGKAVAKKTGWKLRGEDGFKPDNAGQHSRLAYAQAGGIVFEPFFIS
NDTDLALFKTTKWGICRAIADAIAMELGAAKV

3D structure

• PDB: 3czx The crystal structure of the putative N-acetylmuramoyl-L-alanine amidase from Neisseria meningitidis.
• Chain: A
• Resolution: 1.6 Å

Enzymatic activity

• Enzyme Commision number: 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	H11 E25 H77	H12 E26 H78

Gene Ontology

Molecular Function

• GO:0008745 N-acetylmuramoyl-L-alanine amidase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009253 peptidoglycan catabolic process

Cellular Component

• GO:0030288 outer membrane-bounded periplasmic space

External links

• PDB: RCSB:3czx, PDBe:3czx, PDBj:3czx
• PDBsum: 3czx
• UniProt: Q9JZE9