Structure of PDB 3cx7 Chain A

Receptor sequence

>3cx7A (length=319) Species: 10090 (Mus musculus)

RLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGM
RVLVDAREKLHIPWGDNKNQLHGDKLMAFDTRAPMAAQGMVETRVFLQYL
PAIRALWEDSGIQNAYDRRREFQLGESVKYFLDNLDKLGVPDYIPSQQDI
LLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFL
VSSSEFDQVLMEDRQTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLL
EEKVQVVSIKDYFLEFEGDPHCLRDVQKFLVECFRGKRRDPLYHHFTTAI
NTENIRLVFRDVKDTILHD

3D structure

• PDB: 3cx7 Recognition of the Activated States of Galpha13 by the rgRGS Domain of PDZRhoGEF.
• Chain: A
• Resolution: 2.25 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E58 T63 R200 D222 Q226
• Catalytic site (residue number reindexed from 1): E12 T17 R154 D176 Q180

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	S62 T203	S16 T157
BS02	ALF	A	G57 E58 R200 P202 T203 G224 G225 Q226	G11 E12 R154 P156 T157 G178 G179 Q180
BS03	GDP	A	E58 S59 G60 K61 S62 T63 L198 R200 N291 K292 D294 L295 T348 A349 I350	E12 S13 G14 K15 S16 T17 L152 R154 N245 K246 D248 L249 T298 A299 I300

Gene Ontology

Molecular Function

• GO:0001664 G protein-coupled receptor binding
• GO:0003924 GTPase activity
• GO:0019001 guanyl nucleotide binding
• GO:0031683 G-protein beta/gamma-subunit complex binding

Biological Process

• GO:0007165 signal transduction
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007266 Rho protein signal transduction

External links

• PDB: RCSB:3cx7, PDBe:3cx7, PDBj:3cx7
• PDBsum: 3cx7
• PubMed: 18940608
• UniProt: P27601|GNA13_MOUSE Guanine nucleotide-binding protein subunit alpha-13 (Gene Name=Gna13)