Structure of PDB 3cwz Chain A

Receptor sequence

>3cwzA (length=166) Species: 9606 (Homo sapiens) [Search protein sequence]

RKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRT
VRLQLWDTAGLERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDV
RTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGY
NVKQLFRRVAAALPGM

3D structure

PDB

3cwz Structural basis for recruitment of Rab6-interacting protein 1 to Golgi via a RUN domain.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	K26 T27 T45 D68	K15 T16 T34 D57
BS02	GTP	A	S23 G25 K26 T27 S28 F38 N40 Y42 Q43 A44 T45 A70 G71 N126 K127 D129 A157 K158	S12 G14 K15 T16 S17 F27 N29 Y31 Q32 A33 T34 A59 G60 N115 K116 D118 A146 K147

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0019904	protein domain specific binding
GO:0031489	myosin V binding

	Biological Process
GO:0006886	intracellular protein transport
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0006891	intra-Golgi vesicle-mediated transport
GO:0015031	protein transport
GO:0016192	vesicle-mediated transport
GO:0018125	peptidyl-cysteine methylation
GO:0019882	antigen processing and presentation
GO:0031175	neuron projection development
GO:0034067	protein localization to Golgi apparatus
GO:0034498	early endosome to Golgi transport
GO:0042147	retrograde transport, endosome to Golgi
GO:0072385	minus-end-directed organelle transport along microtubule
GO:1903292	protein localization to Golgi membrane

	Cellular Component
GO:0000139	Golgi membrane
GO:0002080	acrosomal membrane
GO:0005789	endoplasmic reticulum membrane
GO:0005794	Golgi apparatus
GO:0005802	trans-Golgi network
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0012505	endomembrane system
GO:0016020	membrane
GO:0030667	secretory granule membrane
GO:0031410	cytoplasmic vesicle
GO:0032588	trans-Golgi network membrane
GO:0070062	extracellular exosome
GO:0070381	endosome to plasma membrane transport vesicle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3cwz, PDBe:3cwz, PDBj:3cwz
PDBsum	3cwz
PubMed	19141279
UniProt	P20340\|RAB6A_HUMAN Ras-related protein Rab-6A (Gene Name=RAB6A)

[Back to BioLiP]