Structure of PDB 3csm Chain A

Receptor sequence

>3csmA (length=252) Species: 4932 (Saccharomyces cerevisiae)

MDFTKPETVLNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGL
EIPNFKGSFLDWALSNLEIAHSRIRRFESPDETPFFPDKIQKSFLPSINY
PQILAPYAPEVNYNDKIKKVYIEKIIPLISKRDGDDKNNFGSVATRDIEC
LQSLSRRIHFGKFVAEAKFQSDIPLYTKLIKSKDVEGIMKNITNSAVEEK
ILERLTKKAEVYGVDPTERRITPEYLVKIYKEIVIPITKEVEVEYLLRRL
EE

3D structure

• PDB: 3csm Mechanisms of catalysis and allosteric regulation of yeast chorismate mutase from crystal structures.
• Chain: A
• Resolution: 3.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R16 R157 K168 N194 E198 T242 E246
• Catalytic site (residue number reindexed from 1): R16 R157 K168 N194 E198 T238 E242
• Enzyme Commision number: 5.4.99.5: chorismate mutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TRP	A	H71 I74 R76	H71 I74 R76
BS02	TSA	A	R16 R157 K168 I192 T193 E198 I239 K243 E246	R16 R157 K168 I192 T193 E198 I235 K239 E242

Gene Ontology

Molecular Function

• GO:0004106 chorismate mutase activity
• GO:0005515 protein binding
• GO:0016853 isomerase activity
• GO:0072545 L-tyrosine binding
• GO:0120284 tryptophan binding

Biological Process

• GO:0006571 tyrosine biosynthetic process
• GO:0009073 aromatic amino acid family biosynthetic process
• GO:0009094 L-phenylalanine biosynthetic process
• GO:0046417 chorismate metabolic process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:3csm, PDBe:3csm, PDBj:3csm
• PDBsum: 3csm
• PubMed: 9384560
• UniProt: P32178|CHMU_YEAST Chorismate mutase (Gene Name=ARO7)