Structure of PDB 3cr3 Chain A

Receptor sequence
>3cr3A (length=192) Species: 272623 (Lactococcus lactis subsp. lactis Il1403) [Search protein sequence]
LLTIDTTIEWLGKFNEKIQENKAYLSELDGPIGDGDHGANMARGMSETMK
ALEVSNFGNVSEIFKKVAMTLMSKVGGASGPLYGSAFLAMSKTAIETLDT
SELIYAGLEAIQKRGKAQVGEKTMVDIWSAFLNDLQTDSASKDNLEKVVK
ASAGLLATKGRASYLGERSIGHIDPGTQSSAYLFETLLEVVA
3D structure
PDB3cr3 X-ray Structures of the Three Lactococcus lactis Dihydroxyacetone Kinase Subunits and of a Transient Intersubunit Complex.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.1.121: phosphoenolpyruvate--glycerone phosphotransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A D29 D34 D36 D29 D34 D36
BS02 MG A D34 D36 D34 D36
BS03 ADP A D29 D34 D36 H37 N40 G77 A78 S79 L82 G115 A117 T123 D174 P175 G176 D29 D34 D36 H37 N40 G77 A78 S79 L82 G115 A117 T123 D174 P175 G176
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004371 glycerone kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016772 transferase activity, transferring phosphorus-containing groups
GO:0046872 metal ion binding
GO:0047324 phosphoenolpyruvate-glycerone phosphotransferase activity
Biological Process
GO:0006071 glycerol metabolic process
GO:0016310 phosphorylation
GO:0019563 glycerol catabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3cr3, PDBe:3cr3, PDBj:3cr3
PDBsum3cr3
PubMed18957416
UniProtQ9CIV7|DHAL_LACLA PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL (Gene Name=dhaL)

[Back to BioLiP]