Structure of PDB 3cph Chain A

Receptor sequence
>3cphA (length=175) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
IMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKV
KLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVN
EHANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNV
NEIFFTLAKLIQEKIDSNKLVGVGN
3D structure
PDB3cph A structural model of the GDP dissociation inhibitor rab membrane extraction mechanism.
ChainA
Resolution2.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Q79
Catalytic site (residue number reindexed from 1) Q60
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP A S29 G30 V31 G32 K33 S34 C35 F45 F49 N133 K134 D136 M137 S162 A163 K164 S10 G11 V12 G13 K14 S15 C16 F26 F30 N114 K115 D117 M118 S143 A144 K145 PDBbind-CN: -logKd/Ki=6.48,Kd=0.33uM
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
Biological Process
GO:0006887 exocytosis
GO:0006893 Golgi to plasma membrane transport
GO:0006906 vesicle fusion
GO:0006914 autophagy
GO:0007107 membrane addition at site of cytokinesis
GO:0009306 protein secretion
GO:0015031 protein transport
GO:0031321 ascospore-type prospore assembly
Cellular Component
GO:0000131 incipient cellular bud site
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0005768 endosome
GO:0005783 endoplasmic reticulum
GO:0005886 plasma membrane
GO:0005935 cellular bud neck
GO:0030133 transport vesicle
GO:0030658 transport vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0031982 vesicle
GO:0043332 mating projection tip

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3cph, PDBe:3cph, PDBj:3cph
PDBsum3cph
PubMed18426803
UniProtP07560|SEC4_YEAST Ras-related protein SEC4 (Gene Name=SEC4)

[Back to BioLiP]