Structure of PDB 3coq Chain A

Receptor sequence
>3coqA (length=89) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
EQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEV
ESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGL
3D structure
PDB3coq Structural basis for dimerization in DNA recognition by gal4.
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K17 K18 L49 T50 R51 K10 K11 L42 T43 R44 PDBbind-CN: Kd=24.6nM
BS02 dna A Q9 A10 R15 K18 K20 C21 K23 L49 Q2 A3 R8 K11 K13 C14 K16 L42 PDBbind-CN: Kd=24.6nM
BS03 ZN A C11 C14 C21 C4 C7 C14
BS04 ZN A C11 C31 C38 C4 C24 C31
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3coq, PDBe:3coq, PDBj:3coq
PDBsum3coq
PubMed18611375
UniProtP04386|GAL4_YEAST Regulatory protein GAL4 (Gene Name=GAL4)

[Back to BioLiP]