Structure of PDB 3con Chain A

Receptor sequence
>3conA (length=156) Species: 9606 (Homo sapiens) [Search protein sequence]
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGET
CLLDILDTAGMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPM
VLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVR
EIRQYR
3D structure
PDB3con Crystal structure of the human NRAS GTPase bound with GDP.
ChainA
Resolution1.649 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP A G13 V14 G15 K16 S17 A18 F28 V29 D30 N116 K117 D119 L120 S145 A146 K147 G13 V14 G15 K16 S17 A18 F28 V29 D30 N105 K106 D108 L109 S134 A135 K136
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0044877 protein-containing complex binding
Biological Process
GO:0000165 MAPK cascade
GO:0001938 positive regulation of endothelial cell proliferation
GO:0007165 signal transduction
GO:0007265 Ras protein signal transduction
GO:0045445 myoblast differentiation
Cellular Component
GO:0000139 Golgi membrane
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0070062 extracellular exosome
GO:0070821 tertiary granule membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3con, PDBe:3con, PDBj:3con
PDBsum3con
PubMed
UniProtP01111|RASN_HUMAN GTPase NRas (Gene Name=NRAS)

[Back to BioLiP]