Structure of PDB 3cni Chain A |
>3cniA (length=145) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence] |
QKVAIVREDTGTIAELAEKALGNMVDIVYAGSDLKEAEEAVKKEKAPAII VIPKGFSQSLESGEKARLEIVWYLRGTGLSEAVSTGTISSLIESLKVQLA SFLLNDPKKAQLLFDPLEIVQHTYLRGSLFKNHSPEAIMNVFYSQ |
|
PDB | 3cni Structural characterization of the putative ABC-type 2 transporter from Thermotoga maritima MSB8. |
Chain | A |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
S135 E182 |
S89 E136 |
|
|
|
|