Structure of PDB 3cix Chain A

Receptor sequence

>3cixA (length=346) Species: 243274 (Thermotoga maritima MSB8)

TGREILEKLERREFTREVLKEALSINDRGFNEALFKLADEIRRKYVGDEV
HIRAIIEFSNVCRKNCLYCGLRRDNKNLKRYRMTPEEIVERARLAVQFGA
KTIVLQSGEDPYYMPDVISDIVKEIKKMGVAVTLSLGEWPREYYEKWKEA
GADRYLLRHETANPVLHRKLRPDTSFENRLNCLLTLKELGYETGAGSMVG
LPGQTIDDLVDDLLFLKEHDFDMVGIGPFIPHPDTPLANEKKGDFTLTLK
MVALTRILLPDSNIPATTAMGTIVPGGREITLRCGANVIMPNWTPSPYRQ
LYQLYPGKICVFEKDTACIPCVMKMIELLGRKPGRDWGGRKRVFET

3D structure

• PDB: 3cix X-ray Structure of the [FeFe]-Hydrogenase Maturase HydE from Thermotoga maritima
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C63 C67 C70 V105 T134 G195 P266
• Catalytic site (residue number reindexed from 1): C62 C66 C69 V104 T133 G194 P265
• Enzyme Commision number: 1.8.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	C63 K65 C67 C70	C62 K64 C66 C69
BS02	SAH	A	Y69 Q107 S108 R159 E161 M199 I231 Y306	Y68 Q106 S107 R158 E160 M198 I230 Y305
BS03	FES	A	R279 C311 C319 C322	R278 C310 C318 C321

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016491 oxidoreductase activity
• GO:0016740 transferase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0042364 water-soluble vitamin biosynthetic process
• GO:0044272 sulfur compound biosynthetic process

External links

• PDB: RCSB:3cix, PDBe:3cix, PDBj:3cix
• PDBsum: 3cix
• PubMed: 18400755
• UniProt: Q9X0Z6|HYDE_THEMA [FeFe] hydrogenase maturase subunit HydE (Gene Name=TM_1269)