Structure of PDB 3ciu Chain A

Receptor sequence

>3ciuA (length=140) Species: 9913 (Bos taurus)

LSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHG
SAQVKGHGAKVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLL
SHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR

3D structure

• PDB: 3ciu Site-Selective Glycosylation of Cysteine-93 beta on the Surface of Bovine Hemoglobin and its Application as a Novel Oxygen Therapeutic
• Chain: A
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	F43 H45 H58 K61 V62 L83 H87 L91 N97 F98 L101 L136	F42 H44 H57 K60 V61 L82 H86 L90 N96 F97 L100 L135

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:3ciu, PDBe:3ciu, PDBj:3ciu
• PDBsum: 3ciu
• UniProt: P01966|HBA_BOVIN Hemoglobin subunit alpha (Gene Name=HBA)