Structure of PDB 3ch5 Chain A

Receptor sequence

>3ch5A (length=193) Species: 9606 (Homo sapiens) [Search protein sequence]

PQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNR
GPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHR
DLVRVCENIPIVLCGNKVDIKDRKVKAKSINLQYYDISAKSNYNFEKPFL
WLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQ

3D structure

PDB

3ch5 The Crystal Structure of the Ran-Nup153ZnF2 Complex: a General Ran Docking Site at the Nuclear Pore Complex

Chain

Resolution

2.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	A	G19 G20 T21 G22 K23 T24 T25 N122 K123 D125 I126 S150 A151 K152	G13 G14 T15 G16 K17 T18 T19 N116 K117 D119 I120 S138 A139 K140

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003682	chromatin binding
GO:0003723	RNA binding
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005049	nuclear export signal receptor activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0019003	GDP binding
GO:0019904	protein domain specific binding
GO:0044877	protein-containing complex binding
GO:0045296	cadherin binding
GO:0045505	dynein intermediate chain binding
GO:0046872	metal ion binding
GO:0046982	protein heterodimerization activity
GO:0061676	importin-alpha family protein binding
GO:0070883	pre-miRNA binding

	Biological Process
GO:0000054	ribosomal subunit export from nucleus
GO:0000055	ribosomal large subunit export from nucleus
GO:0000056	ribosomal small subunit export from nucleus
GO:0000070	mitotic sister chromatid segregation
GO:0000278	mitotic cell cycle
GO:0006259	DNA metabolic process
GO:0006606	protein import into nucleus
GO:0006611	protein export from nucleus
GO:0006913	nucleocytoplasmic transport
GO:0007052	mitotic spindle organization
GO:0007286	spermatid development
GO:0008104	protein localization
GO:0014070	response to organic cyclic compound
GO:0015031	protein transport
GO:0016032	viral process
GO:0021766	hippocampus development
GO:0030036	actin cytoskeleton organization
GO:0031503	protein-containing complex localization
GO:0032092	positive regulation of protein binding
GO:0035281	pre-miRNA export from nucleus
GO:0042307	positive regulation of protein import into nucleus
GO:0046039	GTP metabolic process
GO:0051301	cell division
GO:0061015	snRNA import into nucleus
GO:0071389	cellular response to mineralocorticoid stimulus
GO:1902570	protein localization to nucleolus

	Cellular Component
GO:0000785	chromatin
GO:0001673	male germ cell nucleus
GO:0002177	manchette
GO:0005634	nucleus
GO:0005635	nuclear envelope
GO:0005643	nuclear pore
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005814	centriole
GO:0005829	cytosol
GO:0016020	membrane
GO:0030496	midbody
GO:0032991	protein-containing complex
GO:0036126	sperm flagellum
GO:0042470	melanosome
GO:0042565	RNA nuclear export complex
GO:0055037	recycling endosome
GO:0070062	extracellular exosome
GO:0090543	Flemming body

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3ch5, PDBe:3ch5, PDBj:3ch5
PDBsum	3ch5
PubMed	18611384
UniProt	P62826\|RAN_HUMAN GTP-binding nuclear protein Ran (Gene Name=RAN)

[Back to BioLiP]