Structure of PDB 3cga Chain A

Receptor sequence
>3cgaA (length=87) Species: 9606 (Homo sapiens) [Search protein sequence]
PLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEA
AFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFF
3D structure
PDB3cga Crystal structure of metastasis-associated protein S100A4 in the active calcium-bound form
ChainA
Resolution2.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D63 N65 D67 E69 E74 D60 N62 D64 E66 E71
BS02 CA A S20 E23 D25 K28 E33 S17 E20 D22 K25 E30
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003779 actin binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0042056 chemoattractant activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0046914 transition metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0050786 RAGE receptor binding
Biological Process
GO:0001837 epithelial to mesenchymal transition
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0050918 positive chemotaxis
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0048471 perinuclear region of cytoplasm
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3cga, PDBe:3cga, PDBj:3cga
PDBsum3cga
PubMed18783790
UniProtP26447|S10A4_HUMAN Protein S100-A4 (Gene Name=S100A4)

[Back to BioLiP]