Structure of PDB 3cg4 Chain A |
>3cg4A (length=126) Species: 323259 (Methanospirillum hungatei JF-1) [Search protein sequence] |
HKGDVMIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGVV LLDIMMPGMDGWDTIRAILDNSLEQGIAIVMLTAKNAPDAKMIGLQEYVV DYITKPFDNEDLIEKTTFFMGFVRNQ |
|
PDB | 3cg4 Crystal Structure of Response Regulator Receiver Domain Protein (Chey-Like) from Methanospirillum hungatei JF-1. |
Chain | A |
Resolution | 1.61 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
D13 D56 M58 |
D10 D53 M55 |
|
|
|
|