Structure of PDB 3cfq Chain A

Receptor sequence

>3cfqA (length=116) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTNP

3D structure

• PDB: 3cfq Identification of a novel ligand binding motif in the transthyretin channel.
• Chain: A
• Resolution: 2.09 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DIF	A	L17 A108 L110 T118 T119	L8 A99 L101 T109 T110	BindingDB: Kd=1000nM,IC50=140000nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3cfq, PDBe:3cfq, PDBj:3cfq
• PDBsum: 3cfq
• PubMed: 19954984
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)