Structure of PDB 3cb8 Chain A

Receptor sequence

>3cb8A (length=244) Species: 83333 (Escherichia coli K-12)

VIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVT
VEDLMKEVVTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACKKEGIHT
CLDTNGFVRRYDPVIDELLEVTDLVMLDLKQMNDEIHQNLVGVSNHRTLE
FAKYLANKNVKVWIRYVVVPGWSDDDDSAHRLGEFTRDMGNVEKIELLPY
HELGKHKWVAMGEEYKLDGVKPPKKETMERVKGILEQYGHKVMF

3D structure

• PDB: 3cb8 Structural basis for glycyl radical formation by pyruvate formate-lyase activating enzyme.
• Chain: A
• Resolution: 2.77 Å

Enzymatic activity

• Enzyme Commision number: 1.97.1.4: [formate-C-acetyltransferase]-activating enzyme.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	V15 D16 F25 H37 N38 L204 K208	V14 D15 F24 H36 N37 L203 K207
BS02	SAM	A	Y35 H37 G77 G78 D104 T105 D129 K131 V168 Y201 H202	Y34 H36 G76 G77 D103 T104 D128 K130 V167 Y200 H201
BS03	SF4	A	C29 M31 C33 C36 W42 G78 N106 K131	C28 M30 C32 C35 W41 G77 N105 K130

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0030955 potassium ion binding
• GO:0043365 [formate-C-acetyltransferase]-activating enzyme activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006006 glucose metabolic process
• GO:0006974 DNA damage response
• GO:0051604 protein maturation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3cb8, PDBe:3cb8, PDBj:3cb8
• PDBsum: 3cb8
• PubMed: 18852451
• UniProt: P0A9N4|PFLA_ECOLI Pyruvate formate-lyase 1-activating enzyme (Gene Name=pflA)