Structure of PDB 3car Chain A

Receptor sequence

>3carA (length=103) Species: 873 (Desulfocurvibacter africanus)

EEDMTHVPTDAFGKLERPAAVFNHDEHNEKAGIESCNACHHVWVNGVLAE
DEDSVGTPCSDCHALEQDGDTPGLQDAYHQQCWGCHEKQAKGPVMCGECH
VKN

3D structure

• PDB: 3car Crystal structure of the oxidised and reduced acidic cytochrome c3from Desulfovibrio africanus.
• Chain: A
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	X1 M4 P8 F22 H24 N28 I33 C36 C39 H40 V55 P58 C59 Y78	X1 M4 P8 F22 H24 N28 I33 C36 C39 H40 V55 P58 C59 Y78
BS02	HEM	A	H41 W43 T57 C59 C62 H63 D70 P72 A77	H41 W43 T57 C59 C62 H63 D70 P72 A77
BS03	HEM	A	F22 H27 A31 I33 C82 C85 H86 G92 P93	F22 H27 A31 I33 C82 C85 H86 G92 P93
BS04	HEM	A	V7 T9 F12 L15 E16 R17 A19 A20 Q75 Y78 H79 W83 H86 C96 C99 H100	V7 T9 F12 L15 E16 R17 A19 A20 Q75 Y78 H79 W83 H86 C96 C99 H100

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:3car, PDBe:3car, PDBj:3car
• PDBsum: 3car
• PubMed: 10398589
• UniProt: P94690|CYC3A_DESAF Acidic cytochrome c3