Structure of PDB 3cag Chain A

Receptor sequence
>3cagA (length=77) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
TDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTI
AGDDTILVVAREPTTGAQLAGMFENLR
3D structure
PDB3cag Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis.
ChainA
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ARG A H125 S129 D132 T142 I143 H32 S36 D39 T49 I50
BS02 ARG A G122 A124 H125 G145 D146 G29 A31 H32 G52 D53
BS03 ARG A G145 D146 D147 T148 G52 D53 D54 T55
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0034618 arginine binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0051259 protein complex oligomerization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3cag, PDBe:3cag, PDBj:3cag
PDBsum3cag
PubMed18703843
UniProtP9WPY9|ARGR_MYCTU Arginine repressor (Gene Name=argR)

[Back to BioLiP]