Structure of PDB 3c1q Chain A |
>3c1qA (length=115) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961) [Search protein sequence] |
FAFKRGISTPDLALITRQLATLVQSGMPLEECLRAVAEQSEKPRIRTMLV AVRAKVTEGYTLSDSLGDYPHVFDELFRSMVAAGEKSGHLDSVLERLADY AENRQKMRSKLQQAS |
|
PDB | 3c1q The three-dimensional structure of the cytoplasmic domains of EpsF from the type 2 secretion system of Vibrio cholerae |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
E151 D155 |
E95 D99 |
|
|
|