Structure of PDB 3c1c Chain A

Receptor sequence
>3c1cA (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB3c1c The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
ChainA
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R440 R442 P443 T445 R463 R472 R483 R516 V517 T518 R3 R5 P6 T8 R26 R35 R46 R79 V80 T81
BS02 dna A R440 Y441 G444 V446 A447 R449 R463 K464 L465 P466 R469 R3 Y4 G7 V9 A10 R12 R26 K27 L28 P29 R32
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3c1c, PDBe:3c1c, PDBj:3c1c
PDBsum3c1c
PubMed18794842
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]