Structure of PDB 3c0x Chain A

Receptor sequence

>3c0xA (length=223) Species: 4932 (Saccharomyces cerevisiae)

NIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRDE
GKTYCMQFEWKNKAYMDHVCLLYDQWVLSPPHKKERVNHLGNLVITWGAQ
TFKHQAFNKLANLFIVNNKKTIPNNLVENYLTPMSLAYWFMDDGGKWDYN
KNSTNKSIVLNTQSFTFEEVEYLVKGLRNKFQLNCYVKINKNKPIIYIDS
MSYLIFYNLIKPYLIPQMMYKLP

3D structure

• PDB: 3c0x Crystal structures of I-SceI complexed to nicked DNA substrates: snapshots of intermediates along the DNA cleavage reaction pathway.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	D44 E61 W62 K63 N90 N94 V96 D150 N152 K193	D42 E59 W60 K61 N88 N92 V94 D148 N150 K191
BS02	dna	A	G13 N15 K17 D44 Y46 R48 R50 E61	G11 N13 K15 D42 Y44 R46 R48 E59
BS03	dna	A	P14 N15 K20 K23 L80 S81 H84 K86 R88 Q102 F104 K105 D144 D145 Y151 N152 N163 Q165 S166 K193 K223	P12 N13 K18 K21 L78 S79 H82 K84 R86 Q100 F102 K103 D142 D143 Y149 N150 N161 Q163 S164 K191 K221
BS04	CA	A	D44 D144	D42 D142
BS05	CA	A	G43 D44 D145	G41 D42 D143

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity

Biological Process

• GO:0006314 intron homing
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005739 mitochondrion

External links

• PDB: RCSB:3c0x, PDBe:3c0x, PDBj:3c0x
• PDBsum: 3c0x
• PubMed: 18424798
• UniProt: P03882|SCE1_YEAST Intron-encoded endonuclease I-SceI (Gene Name=SCEI)