Structure of PDB 3buc Chain A

Receptor sequence

>3bucA (length=200) Species: 9606 (Homo sapiens)

SWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKW
HSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNF
VLINRYKDGSDHICEHRDDERELAPGSPIASVSFGASRDFVFRHKDSRPS
RRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILL

3D structure

• PDB: 3buc Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA.
• Chain: A
• Resolution: 2.59 Å

Enzymatic activity

• Enzyme Commision number: 1.14.11.33: DNA oxidative demethylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	V101 F102 H106 R110 Y122 F124 S125 I168 C169 H171 E175 Y235 R254	V46 F47 H51 R55 Y67 F69 S70 I113 C114 H116 E120 Y177 R196
BS02	dna	A	F102 G103 K104 W105 R198 R241 K242	F47 G48 K49 W50 R143 R183 K184
BS03	MN	A	H171 D173 H236	H116 D118 H178
BS04	AKG	A	Y161 H171 D173 H236 R248 N250 R254	Y106 H116 D118 H178 R190 N192 R196

Gene Ontology

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:3buc, PDBe:3buc, PDBj:3buc
• PDBsum: 3buc
• PubMed: 18432238
• UniProt: Q6NS38|ALKB2_HUMAN DNA oxidative demethylase ALKBH2 (Gene Name=ALKBH2)