Structure of PDB 3bu5 Chain A

Receptor sequence

>3bu5A (length=294) Species: 9606 (Homo sapiens)

DEWEVSREKITLLRELGQGMVYEGNARDIIKGEAETRVAVKTVNESASLR
ERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLR
SLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCM
VAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTS
SDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVT
DLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK

3D structure

• PDB: 3bu5 Structural and biochemical characterization of the KRLB region in insulin receptor substrate-2.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D1132 A1134 R1136 N1137 D1150 E1159 L1171
• Catalytic site (residue number reindexed from 1): D143 A145 R147 N148 D161 E170 L182
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	K1085 S1086 D1132 R1136 K1165 G1166 G1167 K1168 G1169 L1170 L1171 P1172 W1175 S1180 L1181 K1182 G1184 F1186 Q1208	K96 S97 D143 R147 K176 G177 G178 K179 G180 L181 L182 P183 W186 S191 L192 K193 G195 F197 Q219
BS02	MG	A	N1137 D1150	N148 D161
BS03	ATP	A	A1028 K1030 E1077 M1079 D1083 M1139 D1150	A39 K41 E88 M90 D94 M150 D161

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:3bu5, PDBe:3bu5, PDBj:3bu5
• PDBsum: 3bu5
• PubMed: 18278056
• UniProt: P06213|INSR_HUMAN Insulin receptor (Gene Name=INSR)