Structure of PDB 3brd Chain A

Receptor sequence

>3brdA (length=427) Species: 6239 (Caenorhabditis elegans)

VQSLTSDRMIDFLSNKEKYECVISIFHAKVAQKSYGNEKRFFCPPPCIYL
IGQGWKLKKDRVAQLYKTLQQATELVAYIGIGSDTSERQQLDFPNIYDYC
AAKTLYISDSDKRKYFDLNAQFFYGCGMEIGGFVSQRIKVISKPSKKKTD
CKYLCIASGTKVALFNRLRSQTVSTRYLHVEGNAFHASSTKWGAFTIHLF
DDQETDNFAVRDGFVYYGSVVKLVDSVTGIALPRLRIRKVDKQQVILDAS
CSEEPVSQLHKCAFQMIDNELVYLCLSHDKIIQHQATAINEHRHQINDGA
AWTIISTDKAEYRFFEAMGQVANPISPCPVVGSLEVDGHGEASRVELHGR
DFKPNLKVWFGATPVETTFRSEESLHCSIPPVSQVRNEQTHWMFTNRTTG
DVEVPISLVRDDGVVYSSGLTFSYKSL

3D structure

• PDB: 3brd RAM-induced Allostery Facilitates Assembly of a Notch Pathway Active Transcription Complex.
• Chain: A
• Resolution: 2.21 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K233 R234 F235 K368 R397 S400 T402 K476	K39 R40 F41 K143 R167 S170 T172 K242	PDBbind-CN: Kd=0.032uM
BS02	dna	A	K227 Y229 S367 R399 Q401	K33 Y35 S142 R169 Q171	PDBbind-CN: Kd=0.032uM
BS03	peptide	A	A414 F415 D431 D440 N441 F442 A443 V444 D446 G463 I464 A465 P467 I515 Q517 H518	A184 F185 D201 D206 N207 F208 A209 V210 D212 G229 I230 A231 P233 I281 Q283 H284

Gene Ontology

Molecular Function

• GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
• GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006357 regulation of transcription by RNA polymerase II

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:3brd, PDBe:3brd, PDBj:3brd
• PDBsum: 3brd
• PubMed: 18381292
• UniProt: V6CLJ5|LAG1_CAEEL Suppressor of hairless protein homolog (Gene Name=lag-1)