Structure of PDB 3bpu Chain A |
>3bpuA (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMELITVHIVKGPMGFGFTIADSPGGGGQRVKQIVDRSRGLKEGDLIVEV NKKNVQALTHNQVVDMLVESPKGSEVTLLVQRQTRL |
|
PDB | 3bpu Crystal structure of the 3rd PDZ domain of human membrane associated guanylate kinase, C677S and C709S double mutant. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H645 E714 |
H8 E75 |
|
|
|