Structure of PDB 3bo5 Chain A

Receptor sequence

>3bo5A (length=269) Species: 9606 (Homo sapiens)

TEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPG
CICVKTPCLPGTCSCLRHGENYDDNSCLRDKYAEPVFECNVLCRCSDHCR
NRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQ
RRIHLQTKSDSNYIIAIREHVMETFVDPTYIGNIGRFLNHSCEPNLLMIP
VRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSASKERLDHGKLR
KPCYCGAKSCTAFLPFDSS

3D structure

• PDB: 3bo5 The Crystal Structure of Methyltransferase Domain of Human Histone-lysine N-methyltransferase SETMAR in Complex With AdoHcy.
• Chain: A
• Resolution: 1.59 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y154 Y248
• Catalytic site (residue number reindexed from 1): Y139 Y228
• Enzyme Commision number: 2.1.1.357: [histone H3]-lysine(36) N-dimethyltransferase.
  3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C61 C75 C104 C108	C51 C65 C89 C93
BS02	ZN	A	C68 C104 C110 C114	C58 C89 C95 C99
BS03	ZN	A	C61 C63 C68 C73	C51 C53 C58 C63
BS04	ZN	A	C212 C273 C275 C280	C192 C253 C255 C260
BS05	SAH	A	K135 W137 N177 Y178 R206 N209 H210 Y248 R263 C273 Y274 L284	K120 W122 N162 Y163 R186 N189 H190 Y228 R243 C253 Y254 L264

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0042054 histone methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:3bo5, PDBe:3bo5, PDBj:3bo5
• PDBsum: 3bo5
• UniProt: Q53H47|SETMR_HUMAN Histone-lysine N-methyltransferase SETMAR (Gene Name=SETMAR)