Structure of PDB 3bng Chain A

Receptor sequence

>3bngA (length=471) Species: 844 (Wolinella succinogenes) [Search protein sequence]

KTAHSQGIEGKAMSEEWARYYPRQFDSWKKTKESDNITDMLKEKPALVVA
WAGYPFSKDYNAPRGHYYALQDNINTLRTGAPVDGKTGPLPSACWTCKSP
DVPRIIEQDGELEYFTGKWAKYGDEIVNTIGCYNCHDDKSAELKSKVPYL
DRGLSAAGFKTFAESTHQEKRSLVCAQCHVEFYFKKTEWKDDKGVDKTAM
VVTLPWSKGISTEQMEAYYDEINFADWTHGISKTPMLKAQHPDWELYKTG
IHGQKGVSCADCHMPYTQEGAVKYSDHKVGNPLDNMDKSCMNCHRESEQK
LKDIVKQKFERKEFLQDIAFDNIGKAHLETGKAMELGATDAELKEIRTHI
RHAQWRADMAIAGHGSFFHAPEEVLRLLASGNEEAQKARIKLVKVLAKYG
AIDYVAPDFETKEKAQKLAKVDMEAFIAEKLKFKQTLEQEWKKQAIAKGR
LNPESLKGVDEKSSYYDKTKK

3D structure

PDB

3bng Binding and Reduction of Sulfite by Cytochrome c Nitrite Reductase

Chain

Resolution

1.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.7.2.2: nitrite reductase (cytochrome; ammonia-forming).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	A	E217 F218 K274 Q276	E181 F182 K238 Q240
BS02	HEM	A	N97 P99 D108 N109 T112 R114 C130 C133 K134 C214 H215 F218 F220 H277	N61 P63 D72 N73 T76 R78 C94 C97 K98 C178 H179 F182 F184 H241
BS03	HEM	A	Y57 Q60 F61 W64 G167 C168 C171 H172 L179 H203 R207 M300 Y310 S311 H313	Y21 Q24 F25 W28 G131 C132 C135 H136 L143 H167 R171 M264 Y274 S275 H277
BS04	HEM	A	S70 P99 R100 H102 Y104 A105 D108 C133 K134 I166 C211 C214 H215 H299 V315	S34 P63 R64 H66 Y68 A69 D72 C97 K98 I130 C175 C178 H179 H263 V279
BS05	HEM	A	H215 W280 Y283 H288 S294 C295 C298 H299 N317 P318 H400 G401 F404 H405	H179 W244 Y247 H252 S258 C259 C262 H263 N281 P282 H364 G365 F368 H369
BS06	HEM	A	I287 H288 K291 S325 C326 C329 H330 K344 F404	I251 H252 K255 S289 C290 C293 H294 K308 F368

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0016491	oxidoreductase activity
GO:0020037	heme binding
GO:0042279	nitrite reductase (cytochrome, ammonia-forming) activity
GO:0046872	metal ion binding

	Biological Process
GO:0009061	anaerobic respiration
GO:0019645	anaerobic electron transport chain
GO:0042128	nitrate assimilation

	Cellular Component
GO:0030288	outer membrane-bounded periplasmic space
GO:0042597	periplasmic space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3bng, PDBe:3bng, PDBj:3bng
PDBsum	3bng
PubMed	18201106
UniProt	Q9S1E5\|NRFA_WOLSU Cytochrome c-552 (Gene Name=nrfA)

[Back to BioLiP]