Structure of PDB 3bfw Chain A

Receptor sequence
>3bfwA (length=132) Species: 316407 (Escherichia coli str. K-12 substr. W3110) [Search protein sequence]
AKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVT
ASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQS
AHFPLQVRALTVNGGATQGTIQAVISITYTYS
3D structure
PDB3bfw Infinite Kinetic Stability against Dissociation of Supramolecular Protein Complexes through Donor Strand Complementation
ChainA
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A V18 T20 T21 A23 T24 V25 D26 L27 G28 D29 L30 Y31 S32 T129 Q130 G131 T132 I133 Q134 A135 V136 I137 S138 I139 T140 Y141 V6 T8 T9 A11 T12 V13 D14 L15 G16 D17 L18 Y19 S20 T117 Q118 G119 T120 I121 Q122 A123 V124 I125 S126 I127 T128 Y129
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007155 cell adhesion
GO:0007638 mechanosensory behavior
GO:0031589 cell-substrate adhesion
GO:0043709 cell adhesion involved in single-species biofilm formation
Cellular Component
GO:0009289 pilus
GO:0009419 pilus tip

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3bfw, PDBe:3bfw, PDBj:3bfw
PDBsum3bfw
PubMed18400183
UniProtP08190|FIMG_ECOLI Protein FimG (Gene Name=fimG)

[Back to BioLiP]