Structure of PDB 3be4 Chain A

Receptor sequence

>3be4A (length=215) Species: 353152 (Cryptosporidium parvum Iowa II)

GNSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREAIKNGIGL
EAKSIIESGNFVGDEIVLGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLA
KILSEIGDSLTSVIYFEIDDSEIIERISGRCTHPASGRIYHVKYNPPKQP
GIDDVTGEPLVWRDDDNAEAVKVRLDVFHKQTAPLVKFYEDLGILKRVNA
KLPPKEVTEQIKKIL

3D structure

• PDB: 3be4 Crystal structure of Cryptosporidium parvum adenylate kinase cgd5_3360.
• Chain: A
• Resolution: 1.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K18 R93 R132 R165 R176
• Catalytic site (residue number reindexed from 1): K18 R91 R130 R163 R174

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AP5	A	P14 G15 G17 K18 G19 T20 T36 G37 L40 R41 N62 F63 V64 G90 R93 Q97 R128 R132 I141 Y142 H143 Y146 R165 R176 P206	P14 G15 G17 K18 G19 T20 T36 G37 L40 R41 N60 F61 V62 G88 R91 Q95 R126 R130 I139 Y140 H141 Y144 R163 R174 P204

Gene Ontology

Molecular Function

• GO:0004017 adenylate kinase activity
• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0016776 phosphotransferase activity, phosphate group as acceptor
• GO:0019205 nucleobase-containing compound kinase activity
• GO:0050145 nucleoside monophosphate kinase activity

Biological Process

• GO:0006139 nucleobase-containing compound metabolic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0016310 phosphorylation
• GO:0046940 nucleoside monophosphate phosphorylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3be4, PDBe:3be4, PDBj:3be4
• PDBsum: 3be4
• UniProt: Q5CRC5