Structure of PDB 3bbp Chain A

Receptor sequence
>3bbpA (length=161) Species: 9606 (Homo sapiens) [Search protein sequence]
FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVR
LQLWDTAGLERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRT
ERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNV
KQLFRRVAAAL
3D structure
PDB3bbp Rab and Arl GTPase family members cooperate in the localization of the golgin GCC185.
ChainA
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A K26 T27 T45 D68 K13 T14 T32 D55
BS02 GTP A S23 V24 G25 K26 T27 S28 F38 N40 Y42 A44 T45 G71 K127 D129 L130 S156 K158 S10 V11 G12 K13 T14 S15 F25 N27 Y29 A31 T32 G58 K114 D116 L117 S143 K145
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019904 protein domain specific binding
GO:0031489 myosin V binding
Biological Process
GO:0006886 intracellular protein transport
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0006891 intra-Golgi vesicle-mediated transport
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0018125 peptidyl-cysteine methylation
GO:0019882 antigen processing and presentation
GO:0031175 neuron projection development
GO:0034067 protein localization to Golgi apparatus
GO:0034498 early endosome to Golgi transport
GO:0042147 retrograde transport, endosome to Golgi
GO:0072385 minus-end-directed organelle transport along microtubule
GO:1903292 protein localization to Golgi membrane
Cellular Component
GO:0000139 Golgi membrane
GO:0002080 acrosomal membrane
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005802 trans-Golgi network
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0030667 secretory granule membrane
GO:0031410 cytoplasmic vesicle
GO:0032588 trans-Golgi network membrane
GO:0070062 extracellular exosome
GO:0070381 endosome to plasma membrane transport vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3bbp, PDBe:3bbp, PDBj:3bbp
PDBsum3bbp
PubMed18243103
UniProtP20340|RAB6A_HUMAN Ras-related protein Rab-6A (Gene Name=RAB6A)

[Back to BioLiP]