Structure of PDB 3b29 Chain A

Receptor sequence

>3b29A (length=142) Species: 9606 (Homo sapiens) [Search protein sequence]

KDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYR
AQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSA
QLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRL

3D structure

PDB

3b29 Seleno-detergent MAD phasing of leukotriene C4 synthase in complex with dodecyl-beta-D-selenomaltoside

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

2.5.1.-
4.4.1.20: leukotriene-C4 synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	GSH	A	R51 N55 E58 Y59 Y93 Y97 R104 L108	R50 N54 E57 Y58 Y92 Y96 R103 L107
BS02	LSM	A	L7 G77 L81	L6 G76 L80
BS03	LSM	A	L124 A128	L123 A127
BS04	LSM	A	Y109 W116	Y108 W115

Gene Ontology

	Molecular Function
GO:0004364	glutathione transferase activity
GO:0004464	leukotriene-C4 synthase activity
GO:0004602	glutathione peroxidase activity
GO:0005515	protein binding
GO:0008047	enzyme activator activity
GO:0008289	lipid binding
GO:0016740	transferase activity
GO:0016829	lyase activity
GO:0042802	identical protein binding

	Biological Process
GO:0006629	lipid metabolic process
GO:0006691	leukotriene metabolic process
GO:0019370	leukotriene biosynthetic process
GO:0042759	long-chain fatty acid biosynthetic process
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0005634	nucleus
GO:0005635	nuclear envelope
GO:0005640	nuclear outer membrane
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane
GO:0031965	nuclear membrane
GO:0043231	intracellular membrane-bounded organelle

External links

PDB	RCSB:3b29, PDBe:3b29, PDBj:3b29
PDBsum	3b29
PubMed	22139193
UniProt	Q16873\|LTC4S_HUMAN Leukotriene C4 synthase (Gene Name=LTC4S)