Structure of PDB 3ao5 Chain A

Receptor sequence

>3ao5A (length=135) Species: 11676 (Human immunodeficiency virus 1)

SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAG
RWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAE
HLKTAVQMAVFIHNHKRKGGYSAGERIVDIIATDI

3D structure

• PDB: 3ao5 Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLC	A	E87 V88 K173	E31 V32 K103
BS02	BBY	A	H185 R187 S195 G197 E198 V201	H115 R117 S122 G124 E125 V128	MOAD: Kd=5.9mM PDBbind-CN: -logKd/Ki=2.23,Kd=5.9mM
BS03	BBY	A	G106 R107 W108 P109	G50 R51 W52 P53	MOAD: Kd=5.9mM PDBbind-CN: -logKd/Ki=2.23,Kd=5.9mM

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding

Biological Process

• GO:0015074 DNA integration

External links

• PDB: RCSB:3ao5, PDBe:3ao5, PDBj:3ao5
• PDBsum: 3ao5
• PubMed: 21275048
• UniProt: Q72498