Structure of PDB 3amu Chain A

Receptor sequence

>3amuA (length=402) Species: 2234 (Archaeoglobus fulgidus)

HMRVWVGIDDTDSSRGMCTTYLAVLAMERVERELGKVIGFPRLIRLNPTI
PNGAVSFLVEVDDVGELVDVVNEVIIEHAMLDDEKTNPGAVFVDEELAVK
LKPFADKAIKDVLQIDEALFVIGKYFIPHLRHKKGRGLIGALAAVGAELE
DFTLELIAYRYPERFGTEREYDEESFFDMDYELYPQTFDNVDWCNDVVVC
IPNTPCPVLYGIRGESVEALYKAMESVKTEPVDRRMIFVTNHATDMHLIG
EEEVHRLENYRSYRLRGRVTLEPYDIEGGHVFFEIDTKFGSVKCAAFEPT
KQFRNVIRLLRKGDVVEVYGSMKKDTINLEKIQIVELAEIWVEKNPICPE
SAGRGQGFADEKLREKVERELQPGFYEVPPSARRHLSKPLIRMNVEGRHI
FR

3D structure

• PDB: 3amu Structural basis of tRNA agmatinylation essential for AUA codon decoding
• Chain: A
• Resolution: 3.1 Å

Enzymatic activity

• Enzyme Commision number: 6.3.4.22: tRNA(Ile)(2)-agmatinylcytidine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	P206 N207 T208 D279 E281 G282 G283 H284 F286 K297 F301 E302 P303 K305 R308 N309 R312 K328 N332 L333 K348 N349 E360 S361 G363 R364 Q366 K380 A400 R402 H403	P202 N203 T204 D275 E277 G278 G279 H280 F282 K293 F297 E298 P299 K301 R304 N305 R308 K324 N328 L329 K344 N345 E350 S351 G353 R354 Q356 K362 A382 R384 H385
BS02	APC	A	D8 D9 D11 T18 L45 I49 N56 G57 A112 L117 R140 I143 G144	D9 D10 D12 T19 L46 I50 N52 G53 A108 L113 R136 I139 G140
BS03	AG2	A	D193 V203 C204 G215 R217	D189 V199 C200 G211 R213

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0016879 ligase activity, forming carbon-nitrogen bonds

Biological Process

• GO:0002101 tRNA wobble cytosine modification
• GO:0008033 tRNA processing

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3amu, PDBe:3amu, PDBj:3amu
• PDBsum: 3amu
• PubMed: 22002223
• UniProt: O28025|TIAS_ARCFU tRNA(Ile2) 2-agmatinylcytidine synthetase TiaS (Gene Name=tiaS)