Structure of PDB 3amt Chain A

Receptor sequence

>3amtA (length=417) Species: 2234 (Archaeoglobus fulgidus)

HMRVWVGIDDTDSSRGMCTTYLAVLAMERVERELGKVIGFPRLIRLNPTI
PYKTRGNGAVSFLVEVDDVGELVDVVNEVIIEHAMLDDEKTNPGAVFVDE
ELAVKLKPFADKAIKDVLQIDEALFVIGKYFIPHLRHKKGRGLIGALAAV
GAELEDFTLELIAYRYPERFGTEREYDEESFFDMDYELYPQTFDNVDWCN
DVVVCIPNTPCPVLYGIRGESVEALYKAMESVKTEPVDRRMIFVTNHATD
MHLIGEEEVHRLENYRSYRLRGRVTLEPYDIEGGHVFFEIDTKFGSVKCA
AFEPTKQFRNVIRLLRKGDVVEVYGSMKKDTINLEKIQIVELAEIWVEKN
PICGRRMESAGRGQGFRCKCRTKADEKLREKVERELQPGFYEVPPSARRH
LSKPLIRMNVEGRHIFR

3D structure

• PDB: 3amt Structural basis of tRNA agmatinylation essential for AUA codon decoding
• Chain: A
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number: 6.3.4.22: tRNA(Ile)(2)-agmatinylcytidine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	K52 R54 V203 C204 P206 N207 R217 D279 E281 G282 G283 H284 F286 K297 F301 E302 P303 R308 R312 K328 N332 L333 E334 N349 E360 S361 G363 R364 Q366 R369 K380 V396 R402 H403	K53 R55 V204 C205 P207 N208 R218 D280 E282 G283 G284 H285 F287 K298 F302 E303 P304 R309 R313 K329 N333 L334 E335 N350 E358 S359 G361 R362 Q364 R367 K377 V393 R399 H400
BS02	ATP	A	D8 D9 D11 T18 I49 T53 G55 N56 G57 A112 L117 R140 I143	D9 D10 D12 T19 I50 T54 G56 N57 G58 A113 L118 R141 I144

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0016879 ligase activity, forming carbon-nitrogen bonds

Biological Process

• GO:0002101 tRNA wobble cytosine modification
• GO:0008033 tRNA processing

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3amt, PDBe:3amt, PDBj:3amt
• PDBsum: 3amt
• PubMed: 22002223
• UniProt: O28025|TIAS_ARCFU tRNA(Ile2) 2-agmatinylcytidine synthetase TiaS (Gene Name=tiaS)