Structure of PDB 3aky Chain A

Receptor sequence
>3akyA (length=218) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLE
AKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLD
QMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKED
MKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDA
SQPPATVWADFLNKLGKN
3D structure
PDB3aky Stability, activity and structure of adenylate kinase mutants.
ChainA
Resolution2.23 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K17 R93 R132 R165 R176
Catalytic site (residue number reindexed from 1) K15 R91 R130 R163 R174
Enzyme Commision number 2.7.4.3: adenylate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AP5 A G14 G16 K17 G18 T19 T35 G36 R40 M57 G61 V63 M68 R93 Q97 R128 R132 S141 Y142 H143 F146 R165 R176 Q204 P206 G12 G14 K15 G16 T17 T33 G34 R38 M55 G59 V61 M66 R91 Q95 R126 R130 S139 Y140 H141 F144 R163 R174 Q202 P204
Gene Ontology
Molecular Function
GO:0003688 DNA replication origin binding
GO:0004017 adenylate kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016776 phosphotransferase activity, phosphate group as acceptor
GO:0019205 nucleobase-containing compound kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006172 ADP biosynthetic process
GO:0006270 DNA replication initiation
GO:0009117 nucleotide metabolic process
GO:0016310 phosphorylation
GO:0036388 pre-replicative complex assembly
GO:0046033 AMP metabolic process
GO:0046034 ATP metabolic process
GO:0046940 nucleoside monophosphate phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3aky, PDBe:3aky, PDBj:3aky
PDBsum3aky
PubMed7635152
UniProtP07170|KAD2_YEAST Adenylate kinase (Gene Name=ADK1)

[Back to BioLiP]