Structure of PDB 3akn Chain A

Receptor sequence
>3aknA (length=130) Species: 10116 (Rattus norvegicus) [Search protein sequence]
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVK
ESSNFRNIDVVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGK
ELIAVREISGNELIQTYTYEGVEAKRIFKK
3D structure
PDB3akn Crystal structures of human and rat intestinal fatty acid binding protein in complex with 11-(Dansylamino)undecanoic acid
ChainA
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 11D A Y14 F17 M18 M21 I23 F55 Y70 L72 D74 W82 R106 Y117 Y14 F17 M18 M21 I23 F55 Y70 L72 D74 W82 R106 Y117
Gene Ontology
Molecular Function
GO:0005324 long-chain fatty acid transmembrane transporter activity
GO:0005504 fatty acid binding
GO:0008289 lipid binding
GO:0036041 long-chain fatty acid binding
Biological Process
GO:0006631 fatty acid metabolic process
GO:0015908 fatty acid transport
GO:0015909 long-chain fatty acid transport
GO:0050892 intestinal absorption
GO:0098856 intestinal lipid absorption
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005902 microvillus
GO:0045179 apical cortex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3akn, PDBe:3akn, PDBj:3akn
PDBsum3akn
PubMed
UniProtP02693|FABPI_RAT Fatty acid-binding protein, intestinal (Gene Name=Fabp2)

[Back to BioLiP]