Structure of PDB 3akm Chain A

Receptor sequence
>3akmA (length=131) Species: 9606 (Homo sapiens) [Search protein sequence]
AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVK
ESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGN
ELNTVREIIGDELVQTYVYEGVEAKRIFKKD
3D structure
PDB3akm Crystal structures of human and rat intestinal fatty acid binding proteins in complex with 11-(Dansylamino)undecanoic acid
ChainA
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 11D A Y14 F17 M18 M21 V23 K27 E51 F55 Y70 L72 A73 D74 W82 R106 Y117 Y14 F17 M18 M21 V23 K27 E51 F55 Y70 L72 A73 D74 W82 R106 Y117 BindingDB: Ki=3e+2nM,Kd=3.6e+2nM
Gene Ontology
Molecular Function
GO:0005324 long-chain fatty acid transmembrane transporter activity
GO:0005504 fatty acid binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0036041 long-chain fatty acid binding
Biological Process
GO:0006631 fatty acid metabolic process
GO:0015908 fatty acid transport
GO:0015909 long-chain fatty acid transport
GO:0050892 intestinal absorption
GO:0098856 intestinal lipid absorption
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005902 microvillus
GO:0045179 apical cortex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3akm, PDBe:3akm, PDBj:3akm
PDBsum3akm
PubMed
UniProtP12104|FABPI_HUMAN Fatty acid-binding protein, intestinal (Gene Name=FABP2)

[Back to BioLiP]