Structure of PDB 3add Chain A

Receptor sequence

>3addA (length=251) Species: 243232 (Methanocaldococcus jannaschii DSM 2661)

HHHMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWK
EKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNY
AIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLI
IDTTKDIDFNEIAKKLIEKSKEIPKFYVLEENKNKNNNISDKIDKETRKI
VSEYIKSKKLDKDKIKEVVELRKEFLKKIKKMEEVDADRVLKEFKDLLNS
Y

3D structure

• PDB: 3add Structural Basis for the Major Role of O-Phosphoseryl-tRNA Kinase in the UGA-Specific Encoding of Selenocysteine
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	M82 K91 I120 M128 K138 K182 N183 D191 R195 S199 I202 K203 K209 V216 R219 K220 K224 K227	M85 K94 I123 M131 K141 K185 N186 D194 R198 S202 I205 K206 K212 V219 R222 K223 K227 K230
BS02	ANP	A	P9 G10 G12 K13 S14 T15 R112 R116 T150	P12 G13 G15 K16 S17 T18 R115 R119 T153

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0016773 phosphotransferase activity, alcohol group as acceptor
• GO:0043915 L-seryl-tRNA(Sec) kinase activity

Biological Process

• GO:0001717 conversion of seryl-tRNAsec to selenocys-tRNAsec
• GO:0002098 tRNA wobble uridine modification
• GO:0016310 phosphorylation

External links

• PDB: RCSB:3add, PDBe:3add, PDBj:3add
• PDBsum: 3add
• PubMed: 20705242
• UniProt: Q58933|PSTK_METJA L-seryl-tRNA(Sec) kinase (Gene Name=pstK)