Structure of PDB 3abw Chain A

Receptor sequence
>3abwA (length=260) Species: 348780 (Natronomonas pharaonis DSM 2160) [Search protein sequence]
EVTQRELFEFVLNDPLLASSLYINIALAGLSILLFVFMTRGLDDPRAKLI
AVSTILVPVVSIASYTGLASGLTISVLEMPAGHFAEGSSVMLGGEEVDGV
VTMWGRYLTWALSTPMILLALGLLAGSNATKLFTAITFDIAMCVTGLAAA
LTTSSHLMRWFWYAISCACFIVVLYILLVEWAQDAKAAGTADIFSTLKLL
TVVMWLGYPIVWALGVEGVAVLPVGYTSWAYSALDIVAKYIFAFLLLNYL
TSNEGVVSGS
3D structure
PDB3abw Binding mode of azide ion to pharaonis halorhodopsin
ChainA
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 RET A W127 T131 M159 Y180 S183 C184 F187 W222 Y225 P226 W229 D252 K256 W110 T114 M142 Y163 S166 C167 F170 W205 Y208 P209 W212 D235 K239
BS02 22B A I49 T56 K65 I32 T39 K48
BS03 AZI A S78 S81 T126 S130 K256 S61 S64 T109 S113 K239
BS04 22B A F155 V189 I193 F138 V172 I176
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 22 12:16:35 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3abw', asym_id = 'A', title = 'Binding mode of azide ion to pharaonis halorhodopsin'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3abw', asym_id='A', title='Binding mode of azide ion to pharaonis halorhodopsin')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0005216,0006811,0016020', uniprot = '', pdbid = '3abw', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005216,0006811,0016020', uniprot='', pdbid='3abw', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>